PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10032943m
Common NameCICLE_v10032943mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 163aa    MW: 18267.5 Da    PI: 10.0576
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10032943mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.21.7e-3385143159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vk+s+fprsYY+Ct++gC+vkk+v+r+++d+++v++tYeg H+h+
  Ciclev10032943m  85 LDDGYRWRKYGQKVVKNSKFPRSYYKCTHKGCNVKKQVQRNTKDEEIVVTTYEGLHTHP 143
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.9E-3470143IPR003657WRKY domain
SuperFamilySSF1182901.05E-2977144IPR003657WRKY domain
PROSITE profilePS5081130.48180145IPR003657WRKY domain
SMARTSM007741.5E-3885144IPR003657WRKY domain
PfamPF031063.0E-2786143IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MVVVEQSHMD NSHLQSRFSA SHSSLNMGID PRAQEHAVSE FQLYSGGASG TSGSDKAKQS  60
GKKGDHKGTK KHRYAFQTRS QVDILDDGYR WRKYGQKVVK NSKFPRSYYK CTHKGCNVKK  120
QVQRNTKDEE IVVTTYEGLH THPIGKITDS FEQILLKACT TS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-2875142774Probable WRKY transcription factor 4
1wj2_A1e-2875142774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436871.11e-119hypothetical protein CICLE_v10032943mg
RefseqXP_006493229.11e-119PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA23e-47WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLV4TJY41e-119V4TJY4_9R
STRINGPOPTR_0012s10290.12e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.12e-48WRKY DNA-binding protein 75